The short version of Nucleotide fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-05-10. Anything still debated is marked as such rather than presented as settled.
Research on NMN has expanded because NAD+ concentrations decline with age in some tissues and because NAD+ participates in energy metabolism, DNA repair, and signaling. Animal studies have reported changes in NAD+ levels after NMN administration, but human data are more limited and often focus on safety, pharmacokinetics, and biomarker changes. Questions remain about oral absorption, tissue distribution, and whether changes in blood NAD+ reflect changes inside specific organs. NMN is not an approved drug, and claims about its clinical effects should be distinguished from established biochemical findings.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring, a ribose sugar, and a phosphate group. The compound exists in cells as an intermediate in the production of nicotinamide adenine dinucleotide, a central redox cofactor. NMN is distinct from nicotinamide riboside, another related pyridine nucleotide, although the two compounds can converge in metabolic pathways. Its chemical formula is C11H15N2O8P, and it carries a net negative charge at physiological pH.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
| Property | Value | Notes |
|---|---|---|
| Chemical formula | C11H15N2O8P | Pyridinium nucleotide; free acid form |
| Molar mass | 334.22 g/mol | Free acid; salt forms differ |
| Appearance | White to off-white powder | Typical reference material |
| Solubility class | Water-soluble | Hygroscopic under humid conditions |
| Common synonyms | Nicotinamide mononucleotide; NMN | Distinct from nicotinamide riboside |
Beyond its intracellular synthesis, NMN can be taken up from the extracellular environment, although the routes are still debated. Some evidence points to direct transport into cells through specific transporters, while other work suggests dephosphorylation to nicotinamide riboside followed by cellular uptake. Once inside, NMN can be converted to NAD+ by NMN adenylyltransferases; the relative contribution of these routes may differ by tissue, species, and experimental conditions. Researchers continue to investigate which mechanisms dominate in intact organisms and how they affect measured NAD+ levels. Direct measurement in tissues remains technically challenging because NMN can be rapidly metabolized during sample collection.
NMN occurs in many living systems, including bacteria, yeast, plants, and mammals. Dietary sources are present in foods such as edamame, avocado, broccoli, and various meats, but amounts vary widely and are generally lower than those used in research settings. Laboratory production often relies on enzymatic synthesis or chemical phosphorylation of nicotinamide riboside, and commercial material is typically supplied as a white to off-white powder. Because NMN is hygroscopic and sensitive to heat, moisture, and pH extremes, its handling requires care to preserve identity and purity. Aqueous preparation should be done with attention to pH and temperature to limit hydrolysis.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide found in cells. Its structure consists of a nicotinamide ring linked to ribose phosphate, and the compound serves as an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+. In this pathway, nicotinamide phosphoribosyltransferase converts nicotinamide and phosphoribosyl pyrophosphate into NMN, after which NMN adenylyltransferase attaches an adenylate group to produce NAD+. Because NAD+ participates in redox reactions and signaling, NMN occupies a central position in cellular metabolism. The molecule is distinct from nicotinamide riboside, though the two are related in NAD+ precursor research.
NMN is present in small amounts in some foods, including certain vegetables, fruits, and animal products, but food content varies widely and is not well standardized. In laboratory research, NMN is used as a tool compound to study NAD+ metabolism, mitochondrial function, and cellular stress responses. Animal studies have reported changes in NAD+ levels and various physiological measures after NMN administration, but species differences and study designs limit direct extrapolation to humans. Human trials have largely focused on safety, tolerability, and pharmacokinetics, with fewer studies examining clinical endpoints.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide ring attached to a ribose sugar that carries a phosphate group. The molecular formula is C11H15N2O8P, and the molar mass is about 334.22 grams per mole. In cells, NMN is an intermediate in the salvage pathway that recycles nicotinamide to maintain NAD+ levels. It is not the same compound as NAD+, although it is a direct precursor in one enzymatic step.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
This is the largest division of the Society. It marked its 100th anniversary in 2008. The first Chair of the Division was Edward Curtis Franklin. The Organic Division played a part in establishing Organic Syntheses, Inc. and Organic Reactions, Inc. and it maintains close ties to both organizations. The Division's best known activities include organizing symposia (talks and poster sessions) at the biannual ACS National Meetings, for the purpose of recognizing promising Assistant Professors, talented young researchers, outstanding technical contributions from junior-level chemists, in the field of organic chemistry. The symposia also honor national award winners, including the Arthur C. Cope Award, Cope Scholar Award, James Flack Norris Award in Physical Organic Chemistry, Herbert C. Brown Award for Creative Research in Synthetic Methods. The Division helps to organize symposia at the international meeting called Pacifichem and it organizes the biennial National Organic Chemistry Symposium (NOS) which highlights recent advances in organic chemistry and hosts the Roger Adams Award address. The Division also organizes corporate sponsorships to provide fellowships for PhD students and undergraduates. It also organizes the Graduate Research Symposium and manages award and travel grant programs for undergraduates.
The protein is 82.3 kDa and has a 40 amino acid long LEM domain located at its amino-terminal region. In its carboxyl end it has a RNA recognition motif (RRM). The LEM domain is also common to two other integral proteins of the INM: lamina-associated polypeptide 2 (LAP2) and emerin. The LEM segment enables LEMD3 to attach to the barrier-to-autointegration factor (BAF), and therefore, indirectly interact with the chromatin. LEMD3 also has several implications in regulating the cytokine family such as the transforming growth factor beta (TGF-β) and bone morphogenic protein (BMPs). The RRM domain in its carboxylic region attaches to the SMAD (protein) proteins, which is involved in mediating TGF-β cellular signalling. Consequently, LEMD3 indirectly regulates downstream genes. LEMD3 seems to play an important role in regulating the expression of several fundamental genes. LEMD3 has been associated with laminopathies as well as osteopoikilosis. Mutations in the LEMD3 gene have been linked to several genetic diseases such as osteopoikilosis, melorheostosis and Buschke–Ollendorff syndrome.
Individuals with 3-M syndrome have severe prenatal growth retardation due to growth delays during fetal development resulting in a low birth weight. Growth delays continue after birth throughout childhood and adolescence, ultimately leading to a short stature. Growth delays and immature bone development (growth retardation and delayed bone maturation) typically continue after birth (postnatally), leading to short stature (dwarfism) with proportional development of the arms and legs (as opposed to short stature with abnormally small arms and legs). In most cases, infants with 3M syndrome are unusually small and have a low birth weight despite being carried to term.
Although it is a relatively immature area of research, it appears that heterotrimeric G-proteins may also take part in non-GPCR signaling. There is evidence for roles as signal transducers in nearly all other types of receptor-mediated signaling, including integrins, receptor tyrosine kinases (RTKs), cytokine receptors (JAK/STATs), as well as modulation of various other "accessory" proteins such as GEFs, guanine-nucleotide dissociation inhibitors (GDIs) and protein phosphatases. There may even be specific proteins of these classes whose primary function is as part of GPCR-independent pathways, termed activators of G-protein signalling (AGS). Both the ubiquity of these interactions and the importance of Gα vs. Gβγ subunits to these processes are still unclear. There are two principal signal transduction pathways involving the G protein-linked receptors: the cAMP signal pathway and the phosphatidylinositol signal pathway.
Studies in the hematopoietic system disclosed that during endothelial to hematopoietic stem cell transition, ADGRG1 is a transcriptional target of the heptad complex of hematopoietic transcription factors, and is required for hematopoietic cluster formation. Recently, two studies showed that ADGRG1, is a cell autonomous regulator of oligodendrocyte development through Gα12/13 proteins and Rho activation. Della Chiesa et al. demonstrate that ADGRG1 is expressed on CD56dull natural killer (NK) cells. Lin and Hamann's group show all human cytotoxic lymphocytes, including CD56dull NK cells and CD27–CD45RA+ effector-type CD8+ T cells, express ADGRG1.
Sources: en.wikipedia.org
GCaMP is a genetically encoded calcium indicator (GECI) initially developed in 2001 by Junichi Nakai. It is a synthetic fusion of green fluorescent protein (GFP), calmodulin (CaM), and M13, a peptide sequence from myosin light-chain kinase. When bound to Ca2+, GCaMP fluoresces green with a peak excitation wavelength of 480 nm and a peak emission wavelength of 510 nm. It is used in biological research to measure intracellular Ca2+ levels both in vitro and in vivo using virally transfected or transgenic cell and animal lines. The genetic sequence encoding GCaMP can be inserted under the control of promoters exclusive to certain cell types, allowing for cell-type specific expression of GCaMP. Since Ca2+ is a second messenger that contributes to many cellular mechanisms and signaling pathways, GCaMP allows researchers to quantify the activity of Ca2+-based mechanisms and study the role of Ca2+ ions in biological processes of interest.
Not much is known about the mutations in the genes OBS1and CCD8 and their function in growth and development so far. However, the implications of 3M syndrome suggest that both these genes encode for proteins that play a role in the CUL7 ubiquination pathway. Due to the fact that many of the abnormalities associated with this disorder are congenital, the presence of these clinical features at birth is usually sufficient to make the diagnosis. Diagnosis is suggested in children with the following: low birth weight, severe growth retardation, typical facial features, and characteristic radiological findings. In some cases, growth retardation and/or other characteristic findings suggestive of Three M syndrome may be detected before birth by ultrasound. In fetal ultrasonography, reflected sound waves are used to create an image of the developing fetus.
AAA (ATPases Associated with diverse cellular Activities) proteins (more commonly referred to as "triple-A ATPases") are a large group of protein family sharing a common conserved module of approximately 230 amino acid residues. This is a large, functionally diverse protein family belonging to the AAA+ protein superfamily of ring-shaped P-loop NTPases, which exert their activity through the energy-dependent remodeling or translocation of macromolecules. AAA proteins couple chemical energy provided by ATP hydrolysis to conformational changes which are transduced into mechanical force exerted on a macromolecular substrate. AAA proteins are functionally and organizationally diverse, and vary in activity, stability, and mechanism. Members of the AAA family are found in all organisms and they are essential for many cellular functions. They are involved in processes such as DNA replication, protein degradation, membrane fusion, microtubule severing, peroxisome biogenesis, signal transduction and the regulation of gene expression.
ATAC-seq (Assay for Transposase-Accessible Chromatin using sequencing) is a laboratory technique used in molecular biology to assess genome-wide chromatin accessibility. The technique was introduced in 2013 by the labs of Will Greenleaf and Howard Chang at Stanford University as an alternative to MNase-seq, FAIRE-Seq and DNase-Seq with faster turnaround time, simpler protocol, and lower DNA input requirements.
Sources: en.wikipedia.org
Post-crash survivability is the chance that drivers and passengers survive a crash after it occurs. Technology such as Advanced Automatic Collision Notification can automatically place calls to emergency services and send information about a vehicle collision. Cars are much more dangerous to pedestrians than they are to drivers and passengers. Two-thirds of 1.3 million yearly auto related deaths are pedestrians. Since at least the early 1970s, attention has also been given to vehicle design regarding the safety of pedestrians in car-pedestrian collisions. Proposals in Europe would require cars sold there to have a minimum/maximum hood (bonnet) height. From 2006, the use of "bull bars", a fashion on 4x4s and SUVs, became illegal in the European Union, after having been banned on all new cars in 2002. Recent research has explored the use of multimodal sensor fusion to improve pedestrian detection in challenging conditions, including low-light environments and unusual pedestrian postures such as prone or fallen individuals.
MAAs are widespread in the microbial world and have been reported in many microorganisms including heterotrophic bacteria, cyanobacteria, microalgae, ascomycetous and basidiomycetous fungi, as well as some multicellular organisms such as macroalgae and marine animals. Most research done on MAAs is on their light absorbing and radiation protecting properties. The first thorough description of MAAs was done in cyanobacteria living in a high UV radiation environment. The major unifying characteristic among all MAAs is UV light absorption. All MAAs absorb UV light that can be destructive to biological molecules (DNA, proteins, etc.). Though most MAA research is done on their photo-protective capabilities, they are also considered to be multi-functional secondary metabolites that have many cellular functions. MAAs are effective antioxidant molecules and are able to stabilize free radicals within their ring structure. In addition to protecting cells from mutation via UV radiation and free radicals, MAAs are able to boost cellular tolerance to desiccation, salt stress, and heat stress.
The word analgesic derives from Greek an- (ἀν-, "without"), álgos (ἄλγος, "pain"), and -ikos (-ικος, forming adjectives). Such drugs were usually known as "anodynes" before the 20th century. Analgesics are typically classified based on their mechanism of action. Paracetamol, also known as acetaminophen, is a medication used to treat pain and fever. It is typically used for mild to moderate pain. In combination with opioid pain medication, paracetamol is now used for more severe pain such as cancer pain and after surgery. It is typically used either by mouth or rectally but is also available intravenously. Effects last between two and four hours. Paracetamol is classified as a mild analgesic, and is generally safe at recommended doses. Nonsteroidal anti-inflammatory drugs (NSAIDs) are a drug class that groups together drugs that decrease pain and lower fever, and, in higher doses, decrease inflammation. The most prominent members of this group of drugs—aspirin, ibuprofen, naproxen, and diclofenac—are all available over the counter in most countries.
Data from high-throughput chromosome conformation capture experiments, such as Hi-C (experiment) and ChIA-PET, can provide information on the three-dimensional structure and nuclear organization of chromatin. Bioinformatic challenges in this field include partitioning the genome into domains, such as Topologically Associating Domains (TADs), that are organised together in three-dimensional space. Finding the structure of proteins is an important application of bioinformatics. The Critical Assessment of Protein Structure Prediction (CASP) is an open competition where worldwide research groups submit protein models for evaluating unknown protein models.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide and an intermediate in the cellular production of NAD+.
No. NMN is a smaller precursor molecule, while NAD+ is a dinucleotide cofactor used in many reactions. Enzymes called NMNAT convert NMN into NAD+ inside cells.
This question is not fully settled. Some evidence suggests NMN may be dephosphorylated to nicotinamide riboside before uptake, while other studies propose direct transport. Tissue-specific handling in humans remains an open research area.
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It occurs naturally in cells and is also produced commercially as a supplement ingredient.